Enter your credentials to acces your account.
LL-37 is a multifunctional cationic antimicrobial peptide that forms part of the human innate immune defence system. As the only cathelicidin-derived peptide found in humans, LL-37 plays a central role in antimicrobial defence, immune regulation, and tissue repair.
Comprising 37 amino acids, LL-37 is produced primarily by neutrophils, macrophages, and epithelial cells, and is expressed in various tissues including the skin, lungs, and gastrointestinal tract. Researchers value LL-37 for its broad biological activity, making it a key focus in studies relating to immunity, inflammation, and cellular repair mechanisms.
Pure Peptides UK supplies LL-37 in a 5mg lyophilised format for laboratory research use only.
LL-37 has been widely studied for its ability to disrupt microbial membranes and inhibit the growth of bacteria, viruses, and fungi. Its amphipathic α-helical structure allows it to insert into microbial lipid bilayers, leading to membrane destabilisation and lysis. This has made LL-37 a subject of interest in research on antibiotic-resistant pathogens and host defence peptides.
Beyond its antimicrobial effects, LL-37 acts as an immunomodulatory signalling molecule. It influences cytokine production, chemotaxis, and the activation of immune cells. Researchers study LL-37 to understand its role in maintaining immune balance, preventing excessive inflammation, and coordinating the innate and adaptive immune responses.
LL-37 contributes to epithelial regeneration by promoting keratinocyte migration, angiogenesis, and the formation of new extracellular matrix components. Studies have shown that it supports tissue remodelling and may be involved in accelerating wound closure processes under controlled experimental conditions.
Due to its dual role in both promoting and resolving inflammation, LL-37 is frequently investigated in the context of inflammatory disorders such as psoriasis, arthritis, and autoimmune conditions. Its concentration-dependent effects make it a valuable tool for studying the complex regulation of immune-mediated diseases.
Recent studies have highlighted LL-37’s potential influence on tumour microenvironments and cancer cell signalling. Although findings are preliminary, LL-37 has been explored for its possible role in cancer immunotherapy and as a modulator of cell proliferation and apoptosis.
LL-37 is one of the most extensively researched human defence peptides due to its multifunctional biological properties. Its combined antimicrobial, immunomodulatory, and regenerative roles position it as a vital molecule in the exploration of host defence mechanisms and tissue homeostasis. Continued research on LL-37 may offer insights into the molecular interactions underpinning infection control and immune regulation.
Synonyms: Cathelicidin, Antibacterial Protein LL-37, GTPL5527
Amino Acid Sequence: [LL-37, 37 aa]
IUPAC Condensed Sequence: H–Leu–Leu–Gly–Asp–Phe–Phe–Arg–Lys–Ser–Lys–Glu–Lys–Ile–Gly–Lys–Glu–Phe–Lys–Arg–Ile–Val–Gln–Arg–Ile–Lys–Asp–Phe–Leu–Arg–Asn–Leu–Val–Pro–Arg–Thr–Glu–Ser–OH
Molecular Weight: 4493.34 g/mol
CAS Number: 154947-66-7
PubChem CID: 134611881
Further Reference: PubChem Link
Stability: Store lyophilised peptide at –20°C. After reconstitution, aliquot to prevent repeated freeze–thaw cycles. Reconstituted peptide can be stored at 4°C for a limited time. The lyophilised form remains stable until expiry when stored correctly at –20°C.
Source: Biosynthesis
Reconstitution: Reconstitute with Bacteriostatic Water
Usage: Product is prepared for LABORATORY RESEARCH ONLY. LL-37 for sale at Pure Peptides UK is strictly limited to scientific and educational use. Only licensed researchers are authorised to purchase or handle this product.
| Weight | 6 g |
|---|---|
| Cap Colour | Blue |
