WHAT ARE YOU LOOKING FOR?
Your Cart ( 0 )
WHAT ARE YOU LOOKING FOR?
Your Cart ( 0 )
WHAT ARE YOU LOOKING FOR?
Your Cart ( 0 )

IGF-1 Long R3 1mg

1 2 3 4 5 (0)

£49.00

Ex Tax: £40.83
  • in stock
  • SKU: IGF1_LR3-1mg
  • Weight: 6.00g
  • Cap Colour: Blue
Quantity
Price
<5
£58.80
5 - 9
£44.40
10+
£41.82
× IGF-1 Long R3 1mg
SKU: IGF1_LR3-1mg Category: Tag:

Description

IGF-1 Long R3 1mg

IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1) is a synthetic analogue of human IGF-1, engineered for enhanced stability and biological activity in research settings. The modification involves replacing the glutamic acid at position 3 with arginine (“R3”), and extending the N-terminal region by 13 additional amino acids (MFPAMPLLSLFVN), resulting in a longer peptide chain of 83 amino acids compared to the native 70 in human IGF-1.

These structural modifications significantly reduce IGF-1’s binding affinity to IGF-binding proteins (IGFBPs), increasing the availability of the active peptide during in-vitro experimentation. As a result, IGF-1 LR3 is a valuable research tool in studies of cell growth, metabolism, and tissue differentiation. Supplied as a lyophilised powder, it is designed solely for laboratory research.

Research Focus and Areas of Interest

1. Cellular Growth and Differentiation

IGF-1 LR3 is widely used to study cell proliferation and survival mechanisms, particularly in muscle, neural, and epithelial cell lines. By activating the IGF-1 receptor (IGF-1R) and downstream pathways such as PI3K/Akt and MAPK, researchers can explore how growth factors regulate anabolic and regenerative cellular responses.

2. Protein Synthesis and Metabolic Regulation

Because of its interaction with insulin-like signalling cascades, IGF-1 LR3 is a useful model for investigating glucose metabolism, amino acid uptake, and protein synthesis. Studies often focus on its ability to modulate mTOR pathway activity, which governs nutrient-sensitive protein translation and cellular energy homeostasis.

3. Myogenesis and Muscle Research

Research utilising IGF-1 LR3 often examines myoblast differentiation, hypertrophy, and recovery processes. Its prolonged half-life compared with native IGF-1 allows for extended receptor activation, making it ideal for in-vitro investigations into muscle development, regeneration, and repair signalling.

4. Neurotrophic and Cellular Protection Studies

IGF-1 signalling has been linked to neurotrophic and neuroprotective processes, and IGF-1 LR3 provides a consistent model for exploring these effects. Laboratory studies investigate how the analogue may modulate neuronal growth, survival, and synaptic plasticity under various stress or oxidative conditions.

5. Tissue Regeneration and Wound Modelling

In vitro, IGF-1 LR3 is used to explore tissue repair pathways, including fibroblast proliferation and collagen synthesis. Researchers use it as a reference compound when investigating regenerative signalling cascades and cellular responses in wound-healing or tissue-engineering system.

Conclusion

IGF-1 LR3 represents a well-characterised, research-grade analogue of human IGF-1, providing an extended-acting model for the study of growth-factor-mediated signalling. Its unique structure and receptor kinetics make it a cornerstone peptide for laboratory exploration into cellular regeneration, metabolism, and growth dynamics. This compound is not intended for human or veterinary use, and should only be handled by qualified research personnel in controlled environments.


Technical Information:

  • Synonyms: IGF-1 Long R3; IGF1 LR3; LR3-IGF-1; Long Arginine 3-IGF-1

  • Modified Single-Letter Sequence: MFPAMPLLSLFVN–IGF-1 core sequence (83 amino acids total)

  • IUPAC Condensed Amino Acid Sequence: MFPAMPLLSLFVN–GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

  • Molecular Weight: 9117.6 g/mol

  • CAS Number: 143045-27-6

  • PubChem CID: 16130518

  • Further Reference: PubChem Link


Stability, Source, and Handling

  • Stability: Store lyophilised peptide at –20 °C. After reconstitution, aliquot to prevent repeated freeze–thaw cycles. Reconstituted product may be stored short-term at 4 °C. The lyophilised peptide remains stable until expiry when stored correctly.

  • Source: Biosynthetic preparation; produced to research-grade purity.

  • Reconstitution: Reconstitute with acetic acid or a mixture of acetic acid and bacteriostatic water depending on experimental requirements.

  • Usage: Product is prepared for LABORATORY RESEARCH ONLY. IGF-1 LR3 for sale at Pure Peptides UK is limited to scientific research and educational use — purchase permitted only by licensed researchers.

Additional information

Weight 6 g
Cap Colour Blue
0
    0
    Your Basket
    Your basket is emptyReturn to Shop