WHAT ARE YOU LOOKING FOR?
Your Cart ( 65 )
WHAT ARE YOU LOOKING FOR?
Your Cart ( 65 )
WHAT ARE YOU LOOKING FOR?
Your Cart ( 65 )

IGF1 (1-3) DES 1mg

1 2 3 4 5 (0)

£49.00

Ex Tax: £40.83
  • in stock
  • SKU: IGF_DES-1mg
  • Weight: 6.00g
  • Cap Colour: Purple
Quantity
Price
<5
£58.80
5 - 9
£44.40
10+
£41.76
× IGF1 (1-3) DES 1mg
SKU: IGF_DES-1mg Category: Tag: Brand:

Description

IGF1 (1-3) DES 1mg

IGF-DES (1–3), also known as Des(1–3) IGF-1, is a truncated variant of human Insulin-Like Growth Factor 1 (IGF-1) in which the first three amino acids from the N-terminus have been removed. This modification significantly reduces its affinity for IGF-binding proteins (IGFBPs), resulting in a more biologically active analogue in experimental conditions.

The shortened peptide sequence enables greater receptor interaction and enhanced potency in studies of cellular proliferation, differentiation, and tissue regeneration. IGF-DES (1–3) is supplied as a lyophilised powder and is intended strictly for in-vitro and laboratory research use.

Research Focus and Areas of Interest

1. Enhanced IGF-1 Receptor Activation

By removing the first three amino acids, IGF-DES (1–3) shows increased receptor binding and activation compared to native IGF-1. This property makes it a valuable analogue in research exploring IGF-1R signalling cascades, particularly those involving PI3K/Akt and MAPK pathways.

2. Cellular Growth and Repair Mechanisms

The peptide is used to investigate cell proliferation, differentiation, and repair responses in multiple tissue types, including skeletal muscle, fibroblasts, and neuronal cells. Its enhanced potency allows researchers to model localised tissue repair and growth factor kinetics with greater precision.

3. Myogenic and Regenerative Research

IGF-DES (1–3) has been widely employed in myoblast and myotube formation studies, offering insight into the regulation of muscle fibre regeneration and hypertrophy. Its truncated form mimics the naturally occurring IGF-1 metabolites observed in regenerating tissues, providing an accurate model for muscle recovery research.

4. Neurobiological and Cellular Resilience Studies

IGF-DES (1–3) also serves as a research compound in neurotrophic and cytoprotective experiments, aiding in the study of neuronal survival, oxidative stress response, and synaptic maintenance in cultured neural systems.

5. Collagen and Fibroblast Regulation

Due to its influence on fibroblast proliferation and extracellular matrix synthesis, IGF-DES (1–3) is of research interest in models examining collagen production and tissue remodelling, particularly in wound-healing environments.


Conclusion

IGF-DES (1–3) is a potent, research-grade truncated analogue of IGF-1, widely used in experimental models exploring cell growth, tissue repair, and receptor-mediated signalling. Its unique N-terminal modification results in a highly active peptide ideal for controlled laboratory applications. This compound is not intended for human or veterinary use and must only be handled by qualified researchers.


Technical Information

  • Synonyms: IGF-DES 1–3; Insulin-Like Growth Factor 1, Des-(1–3); Des(1–3) IGF-I; 4–70 IGF-I (human)

  • Sequence (Single-Letter): TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

  • IUPAC Condensed: H–Thr–Leu–Cys–Gly–Ala–Glu–Leu–Val–Asp–Ala–Leu–Gln–Phe–Val–Cys–Gly–Asp–Arg–Gly–Phe–Tyr–Phe–Asn–Lys–Pro–Thr–Gly–Tyr–Gly–Ser–Ser–Ser–Arg–Arg–Ala–Pro–Gln–Thr–Gly–Ile–Val–Asp–Glu–Cys–Cys–Phe–Arg–Ser–Cys–Asp–Leu–Arg–Arg–Leu–Glu–Met–Tyr–Cys–Ala–Pro–Leu–Lys–Pro–Ala–Lys–Ser–Ala–OH

  • Molecular Weight: 7,332.5 g/mol

  • CAS Number: 112603-35-7

  • PubChem CID: 135331146

  • Further Reference: PubChem Link


Stability, Source, and Handling

  • Stability: Store lyophilised peptide at –20 °C. After reconstitution, aliquot to prevent repeated freeze–thaw cycles. Reconstituted peptide can be stored short-term at 4 °C. The lyophilised compound remains stable until its expiry date when stored correctly.

  • Source: Biosynthetically produced to research-grade purity.

  • Reconstitution: Reconstitute with Bacteriostatic Water according to laboratory protocol.

  • Usage: Product is prepared for LABORATORY RESEARCH ONLY. IGF-DES (1–3) for sale at Pure Peptides UK is limited to scientific research and educational purposes — available only to licensed researchers.

Additional information

Weight 6 g
Cap Colour Purple
65
    65
    Your Basket
    bacterial-water
    Bacteriostatic Water 30ml
    5 X £14.99 = £74.94 (incl. VAT)
    kisspeptin-supplement
    Kisspeptin - 5mg
    4 X £21.50 = £86.02 (incl. VAT)
    Premium Ipamorelin 5mg
    Premium Ipamorelin 5mg
    4 X £28.99 = £115.96 (incl. VAT)
    DSIP 5mg
    DSIP 5mg
    4 X £15.00 = £60.00 (incl. VAT)
    GHK-Cu 50mg
    GHK-Cu 50mg
    8 X £29.94 = £239.52 (incl. VAT)
    KPV 5mg
    KPV 5mg
    4 X £21.50 = £86.02 (incl. VAT)
    Premium Modified GRF (1-29) 5mg (aka CJC-1295 w/o DAC)
    Premium Modified GRF (1-29) 5mg (aka CJC-1295 w/o DAC)
    4 X £32.50 = £129.98 (incl. VAT)
    bpc-peptide
    BPC-157 5mg
    9 X £13.99 = £125.90 (incl. VAT)
    NAD+ 500mg
    NAD+ 500mg
    3 X £40.00 = £119.99 (incl. VAT)
    MOTS-c 5mg
    MOTS-c 5mg
    5 X £19.50 = £97.50 (incl. VAT)
    SS-31 10mg
    SS-31 10mg
    3 X £30.00 = £90.00 (incl. VAT)
    Premium Thymosin Beta 4 - 5mg (TB500)
    Premium Thymosin Beta 4 - 5mg (TB500)
    7 X £59.99 = £419.92 (incl. VAT)
    Thymosin Alpha 1 10mg
    Thymosin Alpha 1 10mg
    2 X £44.00 = £88.01 (incl. VAT)
    N-Acetyl Selank Amidate 10mg
    N-Acetyl Selank Amidate 10mg
    3 X £21.00 = £63.00 (incl. VAT)